PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0918s0170.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family ERF
Protein Properties Length: 286aa    MW: 31664.4 Da    PI: 7.9911
Description ERF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0918s0170.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP2582.3e-183081255
                     AP2  2 gykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55
                            ++ GVr+++ +g+WvAeI+d ++  ++ r +lg+f taeeAa+a+++a+  l+g
  SapurV1A.0918s0170.1.p 30 KFVGVRQRP-SGKWVAEIKDTTQS-QKIRMWLGTFETAEEAARAYDEAACLLRG 81
                            799******.7*********5432.47**********************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5103220.0073089IPR001471AP2/ERF domain
CDDcd000181.28E-303088No hitNo description
PfamPF008474.0E-133081IPR001471AP2/ERF domain
SuperFamilySSF541712.09E-183090IPR016177DNA-binding domain
Gene3DG3DSA:3.30.730.105.5E-273089IPR001471AP2/ERF domain
SMARTSM003801.6E-343095IPR001471AP2/ERF domain
PRINTSPR003675.0E-83142IPR001471AP2/ERF domain
PRINTSPR003675.0E-85571IPR001471AP2/ERF domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000302Biological Processresponse to reactive oxygen species
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0035865Biological Processcellular response to potassium ion
GO:0048528Biological Processpost-embryonic root development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MEYHQFQKQP KGVSRSKFKE RCSSKTSKNK FVGVRQRPSG KWVAEIKDTT QSQKIRMWLG  60
TFETAEEAAR AYDEAACLLR GSNTRTNFGT HISSNSPISM KIRNLLKHKR SLKQNSSATS  120
TTKSTIKTST IVSTESSFNI SCFLPNDSNI DSFPSSIDNH GSFINGIKQE NKAFDDAYRP  180
DLSGCSIGGL EPVTSQFHPS CSLPSGFDPQ LQFVQEGMCF PKNDGLLSDT SPGPELVEFE  240
RMTVERQISA SLYAMNGGNE YFENAKDSSD ALWDLPTLCQ LFCPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2gcc_A4e-153194668ATERF1
3gcc_A4e-153194668ATERF1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00521DAPTransfer from AT5G19790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002299104.11e-177hypothetical protein POPTR_0001s04190g
TrEMBLB9GLE41e-177B9GLE4_POPTR; Uncharacterized protein
STRINGPOPTR_0001s04190.11e-177(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33413069
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G19790.12e-31related to AP2 11